PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000167107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 292aa    MW: 33927 Da    PI: 6.6691
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000167107genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.6e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W  eEd ll+++++++G g+W++ a++ g++Rt+k+c++rw++yl
    MDP0000167107 22 RGQWILEEDSLLIQYIERHGEGQWNLLAKRSGLRRTGKSCRLRWLNYL 69
                     899*******************************************97 PP

2Myb_DNA-binding53.84.4e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE++l++d++ ++G++ W++Iar+++ gRt++++k++w++
    MDP0000167107  75 RGNLSPEEQLLILDLHSKMGNR-WSKIARYLP-GRTDNEIKNYWRT 118
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7661769IPR017930Myb domain
SuperFamilySSF466892.58E-2920116IPR009057Homeodomain-like
SMARTSM007171.3E-122171IPR001005SANT/Myb domain
PfamPF002496.9E-152269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-212376IPR009057Homeodomain-like
CDDcd001671.81E-102569No hitNo description
PROSITE patternPS0017503746IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.7770124IPR017930Myb domain
SMARTSM007175.5E-1674122IPR001005SANT/Myb domain
PfamPF002493.7E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2377123IPR009057Homeodomain-like
CDDcd001674.85E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSTNTKTLSS NYSGEDDSEL RRGQWILEED SLLIQYIERH GEGQWNLLAK RSGLRRTGKS  60
CRLRWLNYLK PDVKRGNLSP EEQLLILDLH SKMGNRWSKI ARYLPGRTDN EIKNYWRTRV  120
HKQARHLNID TKSREFQNMI RCYWMPRLKQ KIGRETSISS AVLNQNPTIS QPRENNTFQH  180
FTATISPPPQ ILVQEEINMS GTMYNLDVEK QNTEADYCRS SFIFPSEPMD MSKTAQFPEC  240
PPFYCGDNNG YDMESFNLQE SVSADSAPNF PGNSAGDCYV AENNWFDSDF FM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26191244108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.143210.0fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ2678990.0DQ267899.1 Malus x domestica cultivar Royal Gala MYB8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374762.10.0PREDICTED: transcription factor WER-like
TrEMBLQ0QMQ90.0Q0QMQ9_MALDO; MYB8
STRINGPOPTR_0015s03770.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.19e-71myb domain protein 116
Publications ? help Back to Top
  1. Espley RV, et al.
    Red colouration in apple fruit is due to the activity of the MYB transcription factor, MdMYB10.
    Plant J., 2007. 49(3): p. 414-27
    [PMID:17181777]